SLC35E2 antibody (70R-6754)

Rabbit polyclonal SLC35E2 antibody raised against the middle region of SLC35E2

Synonyms Polyclonal SLC35E2 antibody, Anti-SLC35E2 antibody, SLC35E2, MGC126715 antibody, SLC35E20 antibody, MGC138494 antibody, SLC35E2 antibody, KIAA0447 antibody, SLC35E20, Solute Carrier Family 35 Member E2 antibody, MGC117254 antibody, DKFZp686M0869 antibody, MGC104754 antibody, SLC35E2, FLJ44537 antibody, FLJ34996 antibody
Specificity SLC35E2 antibody was raised against the middle region of SLC35E2
Cross Reactivity Human
Applications WB
Immunogen SLC35E2 antibody was raised using the middle region of SLC35E2 corresponding to a region with amino acids AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP
Assay Information SLC35E2 Blocking Peptide, catalog no. 33R-1007, is also available for use as a blocking control in assays to test for specificity of this SLC35E2 antibody


Western Blot analysis using SLC35E2 antibody (70R-6754)

SLC35E2 antibody (70R-6754) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC35E2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC35E2 is a putative transporter.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC35E2 antibody (70R-6754) | SLC35E2 antibody (70R-6754) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors