SLC35F3 antibody (70R-6807)

Rabbit polyclonal SLC35F3 antibody raised against the middle region of SLC35F3

Synonyms Polyclonal SLC35F3 antibody, Anti-SLC35F3 antibody, SLCF3 35 antibody, FLJ37712 antibody, SLCF3 35, SLCF3-35, SLC35F3, SLCF3-35 antibody, Solute Carrier Family 35 Member F3 antibody
Specificity SLC35F3 antibody was raised against the middle region of SLC35F3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLC35F3 antibody was raised using the middle region of SLC35F3 corresponding to a region with amino acids LKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDVSVLFCCNKAFVFLLSW
Assay Information SLC35F3 Blocking Peptide, catalog no. 33R-5111, is also available for use as a blocking control in assays to test for specificity of this SLC35F3 antibody

Images

Western Blot analysis using SLC35F3 antibody (70R-6807)

SLC35F3 antibody (70R-6807) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC35F3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC35F3 is a multi-pass membrane proteinPotential. It belongs to the SLC35F solute transporter family. SLC35F3 is a putative solute transporter.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC35F3 antibody (70R-6807) | SLC35F3 antibody (70R-6807) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors