SLC36A2 antibody (70R-6321)

Rabbit polyclonal SLC36A2 antibody

Synonyms Polyclonal SLC36A2 antibody, Anti-SLC36A2 antibody, Solute Carrier Family 36 Member 2 antibody, SLCA2-36, PAT2 antibody, MGC119660 antibody, TRAMD1 antibody, FLJ16051 antibody, Proton/Amino Acid Symporter 2 antibody, MGC119658 antibody, SLCA2 36, SLC36A2, SLCA2-36 antibody, SLCA2 36 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC36A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLDESPSESAGLKKTKGITVFQALIHLVKGNMGTGILGLPLAVKNAGIL
Assay Information SLC36A2 Blocking Peptide, catalog no. 33R-9067, is also available for use as a blocking control in assays to test for specificity of this SLC36A2 antibody


Western blot analysis using SLC36A2 antibody (70R-6321)

Recommended SLC36A2 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC36A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC36A2 is involved in a pH-dependent electrogenic neuronal transport and sequestration of small amino acids amino acids such as glycine, alanine and proline. SLC36A2 is inhibited by sarcosine.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using SLC36A2 antibody (70R-6321) | Recommended SLC36A2 Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using SLC36A2 antibody (70R-6321) | Skeletal muscle

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors