SLC37A1 antibody (70R-7152)

Rabbit polyclonal SLC37A1 antibody

Synonyms Polyclonal SLC37A1 antibody, Anti-SLC37A1 antibody, FLJ22340 antibody, G3PP antibody, Glycerol-3-Phosphate Transporter 1 antibody, SLC37A1, SLCA1 37 antibody, SLCA1-37, SLCA1 37, SLCA1-37 antibody, Solute Carrier Family 37 Member 1 antibody
Cross Reactivity Human,Rat
Applications WB
Immunogen SLC37A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKIPGVIEFSLCLLFAKLVSYTFLFWLPLYITNVDHLDAKKAGELSTLFD
Assay Information SLC37A1 Blocking Peptide, catalog no. 33R-5087, is also available for use as a blocking control in assays to test for specificity of this SLC37A1 antibody

Images

Western Blot analysis using SLC37A1 antibody (70R-7152)

SLC37A1 antibody (70R-7152) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC37A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC37A1, a member of the sugar-phosphate transport family, transports glycerol-3-phosphate (G3P) between cellular compartments for its utilization in several compartment-specific biochemical pathways.SLC37A1, a member of the sugar-phosphate transport family, transports glycerol-3-phosphate (G3P) between cellular compartments for its utilization in several compartment-specific biochemical pathways.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC37A1 antibody (70R-7152) | SLC37A1 antibody (70R-7152) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors