SLC37A3 antibody (70R-6591)

Rabbit polyclonal SLC37A3 antibody

Synonyms Polyclonal SLC37A3 antibody, Anti-SLC37A3 antibody, SLCA3-37, SLC37A3, Solute Carrier Family 37 Member 3 antibody, SLCA3-37 antibody, MGC32939 antibody, Glycerol-3-Phosphate Transporter 3 antibody, SLCA3 37, SLCA3 37 antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen SLC37A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FFGLLVSPEEIGLSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDS
Assay Information SLC37A3 Blocking Peptide, catalog no. 33R-2888, is also available for use as a blocking control in assays to test for specificity of this SLC37A3 antibody

Images

Immunohistochemical staining using SLC37A3 antibody (70R-6591)

SLC37A3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC37A3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC17A3 may be involved in actively transporting phosphate into cells via Na(+) cotransport.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SLC37A3 antibody (70R-6591) | SLC37A3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X
  • Western Blot analysis using SLC37A3 antibody (70R-6591) | SLC37A3 antibody (70R-6591) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors