SLC37A4 antibody (70R-6294)

Rabbit polyclonal SLC37A4 antibody

Synonyms Polyclonal SLC37A4 antibody, Anti-SLC37A4 antibody, GSD1c antibody, GSD1b antibody, SLC37A4, GSD1d antibody, G6PT3 antibody, Glucose-6-Phosphate Transporter 4 antibody, Solute Carrier Family 37 Member 4 antibody, SLCA4 37 antibody, TRG19 antibody, SLCA4 37, SLCA4-37 antibody, SLCA4-37, PRO0685 antibody, G6PT2 antibody, G6PT1 antibody, MGC15729 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC37A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSFLCLLLIHNEPADVGLRNLDPMPSEGKKGSLKEESTLQELLLSPYLWV
Assay Information SLC37A4 Blocking Peptide, catalog no. 33R-9804, is also available for use as a blocking control in assays to test for specificity of this SLC37A4 antibody


Western Blot analysis using SLC37A4 antibody (70R-6294)

SLC37A4 antibody (70R-6294) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC37A4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC37A4 transports glucose-6-phosphate from the cytoplasm to the lumen of the endoplasmic reticulum. It forms with glucose-6-phosphatase the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it plays a central role in homeostatic regulation of blood glucose levels.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC37A4 antibody (70R-6294) | SLC37A4 antibody (70R-6294) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors