SLC38A3 antibody (70R-7037)

Rabbit polyclonal SLC38A3 antibody raised against the N terminal of SLC38A3

Synonyms Polyclonal SLC38A3 antibody, Anti-SLC38A3 antibody, Solute Carrier Family 38 Member 3 antibody, G17 antibody, SN1 antibody, SLCA3 38 antibody, SLC38A3, SLCA3-38 antibody, SLCA3 38, SLCA3-38
Specificity SLC38A3 antibody was raised against the N terminal of SLC38A3
Cross Reactivity Human,Mouse
Applications WB
Immunogen SLC38A3 antibody was raised using the N terminal of SLC38A3 corresponding to a region with amino acids GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM
Assay Information SLC38A3 Blocking Peptide, catalog no. 33R-3456, is also available for use as a blocking control in assays to test for specificity of this SLC38A3 antibody

Images

Western Blot analysis using SLC38A3 antibody (70R-7037)

SLC38A3 antibody (70R-7037) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC38A3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance As a sodium-dependent amino acid/proton antiporter, SLC38A3 mediates electrogenic cotransport of glutamine and sodium ions in exchange for protons. It also recognises histidine, asparagine and alanine. It may mediate amino acid transport in either direction under physiological conditions and??ay play a role in nitrogen metabolism and synaptic transmission.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC38A3 antibody (70R-7037) | SLC38A3 antibody (70R-7037) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors