SLC38A5 antibody (70R-6804)

Rabbit polyclonal SLC38A5 antibody raised against the N terminal of SLC38A5

Synonyms Polyclonal SLC38A5 antibody, Anti-SLC38A5 antibody, SLC38A5, pp7194 antibody, JM24 antibody, SLCA5 38, Solute Carrier Family 38 Member 5 antibody, SN2 antibody, SLCA5-38 antibody, SLCA5 38 antibody, SLCA5-38
Specificity SLC38A5 antibody was raised against the N terminal of SLC38A5
Cross Reactivity Human
Applications WB
Immunogen SLC38A5 antibody was raised using the N terminal of SLC38A5 corresponding to a region with amino acids GIRAYEQLGQRAFGPAGKVVVATVICLHNVGAMSSYLFIIKSELPLVIGT
Assay Information SLC38A5 Blocking Peptide, catalog no. 33R-3343, is also available for use as a blocking control in assays to test for specificity of this SLC38A5 antibody

Images

Western Blot analysis using SLC38A5 antibody (70R-6804)

SLC38A5 antibody (70R-6804) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC38A5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a system N sodium-coupled amino acid transporter involved in the transfer of glutamine, asparagine, histidine, serine, alanine, and glycine.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC38A5 antibody (70R-6804) | SLC38A5 antibody (70R-6804) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors