SLC39A10 antibody (70R-6257)

Rabbit polyclonal SLC39A10 antibody

Synonyms Polyclonal SLC39A10 antibody, Anti-SLC39A10 antibody, Solute Carrier Family 39 Member 10 antibody, MGC138428 antibody, SLCA10-39, SLCA10 39 antibody, DKFZp781L10106 antibody, SLCA10 39, LZT-Hs2 antibody, SLC39A10, SLCA10-39 antibody, MGC126565 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen SLC39A10 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHRQHRGMTELEPSKFSKQAAENEKKYYIEKLFERYGENGRLSFFGLEKL
Assay Information SLC39A10 Blocking Peptide, catalog no. 33R-5026, is also available for use as a blocking control in assays to test for specificity of this SLC39A10 antibody

Images

Western Blot analysis using SLC39A10 antibody (70R-6257)

SLC39A10 antibody (70R-6257) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 94 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC39A10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A10 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC39A10 antibody (70R-6257) | SLC39A10 antibody (70R-6257) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors