SLC39A2 antibody (70R-7340)

Rabbit polyclonal SLC39A2 antibody

Synonyms Polyclonal SLC39A2 antibody, Anti-SLC39A2 antibody, SLCA2-39, ZIP2 antibody, SLCA2 39, MGC119190 antibody, SLC39A2, SLCA2-39 antibody, Solute Carrier Family 39 Member 2 antibody, SLCA2 39 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC39A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFFVFFLE
Assay Information SLC39A2 Blocking Peptide, catalog no. 33R-2468, is also available for use as a blocking control in assays to test for specificity of this SLC39A2 antibody

Images

Western Blot analysis using SLC39A2 antibody (70R-7340)

SLC39A2 antibody (70R-7340) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC39A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the ZIP family of metal ion transporters. The encoded protein functions as a zinc transporter. Mutations in this gene may be associated with susceptibility to carotid artery disease.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC39A2 antibody (70R-7340) | SLC39A2 antibody (70R-7340) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors