SLC39A4 antibody (70R-6696)

Rabbit polyclonal SLC39A4 antibody

Synonyms Polyclonal SLC39A4 antibody, Anti-SLC39A4 antibody, SLCA4-39 antibody, Solute Carrier Family 39 Member 4 antibody, MGC74741 antibody, SLCA4-39, SLCA4 39 antibody, SLC39A4, SLCA4 39, ZIP4 antibody, FLJ20327 antibody, AEZ antibody
Cross Reactivity Human
Applications WB
Immunogen SLC39A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLGLHTHSEEGLSPQPTWRLLAMLAGLYAFFLFENLFNLLLPRDPEDLED
Assay Information SLC39A4 Blocking Peptide, catalog no. 33R-9661, is also available for use as a blocking control in assays to test for specificity of this SLC39A4 antibody


Western Blot analysis using SLC39A4 antibody (70R-6696)

SLC39A4 antibody (70R-6696) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC39A4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC39A4 is a member of the zinc/iron-regulated transporter-like protein (ZIP) family. The transmembrane protein is required for zinc uptake in the intestine. Mutations in the gene encoding SLC39A4 result in acrodermatitis enteropathica, a rare inherited defect in the absorption of dietary zinc.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC39A4 antibody (70R-6696) | SLC39A4 antibody (70R-6696) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors