SLC39A7 antibody (70R-6256)

Rabbit polyclonal SLC39A7 antibody

Synonyms Polyclonal SLC39A7 antibody, Anti-SLC39A7 antibody, D6S2244E antibody, SLCA7-39, SLC39A7, Solute Carrier Family 39 Member 7 antibody, ZIP7 antibody, RING5 antibody, KE4 antibody, H2-KE4 antibody, SLCA7 39, D6S115E antibody, SLCA7-39 antibody, HKE4 antibody, SLCA7 39 antibody
Cross Reactivity Human,Dog
Applications WB
Immunogen SLC39A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids HDHEHSHGGYGESGAPGIKQDLDAVTLWAYALGATVLISAAPFFVLFLIP
Assay Information SLC39A7 Blocking Peptide, catalog no. 33R-3709, is also available for use as a blocking control in assays to test for specificity of this SLC39A7 antibody

Images

Western Blot analysis using SLC39A7 antibody (70R-6256)

SLC39A7 antibody (70R-6256) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC39A7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Zinc is an essential cofactor for more than 50 classes of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. Zinc cannot passively diffuse across cell membranes and requires specific transporters, such as SLC39A7, to enter the cytosol from both the extracellular environment and from intracellular storage compartments.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC39A7 antibody (70R-6256) | SLC39A7 antibody (70R-6256) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors