SLC39A8 antibody (70R-6510)

Rabbit polyclonal SLC39A8 antibody

Synonyms Polyclonal SLC39A8 antibody, Anti-SLC39A8 antibody, BIGM103 antibody, LZT-Hs6 antibody, Solute Carrier Family 39 Member 8 antibody, SLC39A8, SLCA8-39 antibody, SLCA8 39, SLCA8-39, SLCA8 39 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC39A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILTPLIKKS
Assay Information SLC39A8 Blocking Peptide, catalog no. 33R-7635, is also available for use as a blocking control in assays to test for specificity of this SLC39A8 antibody

Images

Western Blot analysis using SLC39A8 antibody (70R-6510)

SLC39A8 antibody (70R-6510) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC39A8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the SLC39 family of solute-carrier genes, which show structural characteristics of zinc transporters. The encoded protein is glycosylated and found in the plasma membrane and mitochondria, and functions in the cellular import

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC39A8 antibody (70R-6510) | SLC39A8 antibody (70R-6510) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors