SLC39A9 antibody (70R-6753)

Rabbit polyclonal SLC39A9 antibody

Synonyms Polyclonal SLC39A9 antibody, Anti-SLC39A9 antibody, SLC39A9, SLCA9-39 antibody, FLJ11274 antibody, SLCA9-39, MGC74989 antibody, Solute Carrier Family 39 Member 9 antibody, SLCA9 39, SLCA9 39 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC39A9 antibody was raised using a synthetic peptide corresponding to a region with amino acids YIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAARSSNSKITTTLGLVVHA
Assay Information SLC39A9 Blocking Peptide, catalog no. 33R-10136, is also available for use as a blocking control in assays to test for specificity of this SLC39A9 antibody

Images

Western Blot analysis using SLC39A9 antibody (70R-6753)

SLC39A9 antibody (70R-6753) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC39A9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC39A9 may act as a zinc-influx transporter.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC39A9 antibody (70R-6753) | SLC39A9 antibody (70R-6753) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors