SLC3A1 antibody (70R-6606)

Rabbit polyclonal SLC3A1 antibody raised against the N terminal of SLC3A1

Synonyms Polyclonal SLC3A1 antibody, Anti-SLC3A1 antibody, ATR1 antibody, FLJ34681 antibody, SLCA1 3, NBAT antibody, Solute Carrier Family 3 Member 1 antibody, SLCA1-3, SLC3A1, SLCA1-3 antibody, CSNU1 antibody, D2H antibody, SLCA1 3 antibody, RBAT antibody
Specificity SLC3A1 antibody was raised against the N terminal of SLC3A1
Cross Reactivity Human
Applications WB
Immunogen SLC3A1 antibody was raised using the N terminal of SLC3A1 corresponding to a region with amino acids DFREVDPIFGTMEDFENLVAAIHDKGLKLIIDFIPNHTSDKHIWFQLSRT
Assay Information SLC3A1 Blocking Peptide, catalog no. 33R-1937, is also available for use as a blocking control in assays to test for specificity of this SLC3A1 antibody

Images

Western Blot analysis using SLC3A1 antibody (70R-6606)

SLC3A1 antibody (70R-6606) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 79 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC3A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a type II membrane glycoprotein which is one of the components of the renal amino acid transporter which transports neutral and basic amino acids in the renal tubule and intestinal tract.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC3A1 antibody (70R-6606) | SLC3A1 antibody (70R-6606) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors