SLC41A3 antibody (70R-6669)

Rabbit polyclonal SLC41A3 antibody raised against the C terminal of SLC41A3

Synonyms Polyclonal SLC41A3 antibody, Anti-SLC41A3 antibody, SLC41A3, SLCA3-41 antibody, SLC41A1-L2 antibody, SLCA3 41, SLCA3 41 antibody, Solute Carrier Family 41 Member 3 antibody, FLJ20473 antibody, SLCA3-41
Specificity SLC41A3 antibody was raised against the C terminal of SLC41A3
Cross Reactivity Human
Applications WB
Immunogen SLC41A3 antibody was raised using the C terminal of SLC41A3 corresponding to a region with amino acids WHQALDPDNHCIPYLTGLGDLLGSSSVGHTAAVPRRCTASPGWGLIQPFI
Assay Information SLC41A3 Blocking Peptide, catalog no. 33R-9954, is also available for use as a blocking control in assays to test for specificity of this SLC41A3 antibody

Images

Western Blot analysis using SLC41A3 antibody (70R-6669)

SLC41A3 antibody (70R-6669) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC41A3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC41A3 is a multi-pass membrane protein. It belongs to the SLC41A transporter family. The exact function of SLC41A3 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC41A3 antibody (70R-6669) | SLC41A3 antibody (70R-6669) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors