SLC43A1 antibody (70R-6331)

Rabbit polyclonal SLC43A1 antibody raised against the middle region of SLC43A1

Synonyms Polyclonal SLC43A1 antibody, Anti-SLC43A1 antibody, SLCA1 43, PB39 antibody, POV1 antibody, SLCA1-43, SLCA1-43 antibody, Solute Carrier Family 43 Member 1 antibody, SLC43A1, LAT3 antibody, R00504 antibody, SLCA1 43 antibody
Specificity SLC43A1 antibody was raised against the middle region of SLC43A1
Cross Reactivity Human
Applications WB
Immunogen SLC43A1 antibody was raised using the middle region of SLC43A1 corresponding to a region with amino acids AVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFGAMQLLCLLTCPLI
Assay Information SLC43A1 Blocking Peptide, catalog no. 33R-1608, is also available for use as a blocking control in assays to test for specificity of this SLC43A1 antibody

Images

Western Blot analysis using SLC43A1 antibody (70R-6331)

SLC43A1 antibody (70R-6331) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC43A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids.SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC43A1 antibody (70R-6331) | SLC43A1 antibody (70R-6331) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors