SLC43A2 antibody (70R-6270)

Rabbit polyclonal SLC43A2 antibody raised against the N terminal of SLC43A2

Synonyms Polyclonal SLC43A2 antibody, Anti-SLC43A2 antibody, SLCA2 43, SLCA2-43 antibody, Solute Carrier Family 43 Member 2 antibody, SLCA2 43 antibody, LAT4 antibody, MGC34680 antibody, FLJ23848 antibody, SLC43A2, SLCA2-43
Specificity SLC43A2 antibody was raised against the N terminal of SLC43A2
Cross Reactivity Human
Applications WB
Immunogen SLC43A2 antibody was raised using the N terminal of SLC43A2 corresponding to a region with amino acids TEPENVTNGTVGGTAEPGHEEVSWMNGWLSCQAQDEMLNLAFTVGSFLLS
Assay Information SLC43A2 Blocking Peptide, catalog no. 33R-9053, is also available for use as a blocking control in assays to test for specificity of this SLC43A2 antibody


Western Blot analysis using SLC43A2 antibody (70R-6270)

SLC43A2 antibody (70R-6270) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC43A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC43A2 is a Sodium-, chloride, pH-independent high affinity transport of large neutral amino acids.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC43A2 antibody (70R-6270) | SLC43A2 antibody (70R-6270) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors