SLC43A3 antibody (70R-1888)

Rabbit polyclonal SLC43A3 antibody raised against the N terminal of SLC43A3

Synonyms Polyclonal SLC43A3 antibody, Anti-SLC43A3 antibody, SLCA3-43 antibody, EEG1 antibody, FOAP-13 antibody, SLC43A3, DKFZp762A227 antibody, SLCA3 43, SLCA3 43 antibody, SLCA3-43, PRO1659 antibody, SEEEG-1 antibody, Solute Carrier Family 43 Member 3 antibody
Specificity SLC43A3 antibody was raised against the N terminal of SLC43A3
Cross Reactivity Human
Applications IHC, WB
Immunogen SLC43A3 antibody was raised using the N terminal of SLC43A3 corresponding to a region with amino acids MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPD
Assay Information SLC43A3 Blocking Peptide, catalog no. 33R-5667, is also available for use as a blocking control in assays to test for specificity of this SLC43A3 antibody


Western Blot analysis using SLC43A3 antibody (70R-1888)

SLC43A3 antibody (70R-1888) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC43A3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC43A3 belongs to the SLC43A transporter family and is a putative transporter.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC43A3 antibody (70R-1888) | SLC43A3 antibody (70R-1888) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors