SLC44A3 antibody (70R-6723)

Rabbit polyclonal SLC44A3 antibody raised against the middle region of SLC44A3

Synonyms Polyclonal SLC44A3 antibody, Anti-SLC44A3 antibody, SLCA3-44, SLC44A3, SLCA3-44 antibody, CTL3 antibody, Solute Carrier Family 44 Member 3 antibody, MGC45474 antibody, SLCA3 44, SLCA3 44 antibody
Specificity SLC44A3 antibody was raised against the middle region of SLC44A3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLC44A3 antibody was raised using the middle region of SLC44A3 corresponding to a region with amino acids TFAILIFFWVLWVAVLLSLGTAGAAQVMEGGQVEYKPLSGIRYMWSYHLI
Assay Information SLC44A3 Blocking Peptide, catalog no. 33R-9061, is also available for use as a blocking control in assays to test for specificity of this SLC44A3 antibody

Images

Western Blot analysis using SLC44A3 antibody (70R-6723)

SLC44A3 antibody (70R-6723) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC44A3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC44A3 is a multi-pass membrane protein. It belongs to the CTL (choline transporter-like) family. The function of the RBM34 protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC44A3 antibody (70R-6723) | SLC44A3 antibody (70R-6723) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors