SLC45A2 antibody (70R-6692)

Rabbit polyclonal SLC45A2 antibody raised against the C terminal of SLC45A2

Synonyms Polyclonal SLC45A2 antibody, Anti-SLC45A2 antibody, SLCA2-45, SLC45A2, MATP antibody, AIM1 antibody, SLCA2-45 antibody, 1A1 antibody, SLCA2 45 antibody, SLCA2 45, Solute Carrier Family 45 Member 2 antibody
Specificity SLC45A2 antibody was raised against the C terminal of SLC45A2
Cross Reactivity Human
Applications WB
Immunogen SLC45A2 antibody was raised using the C terminal of SLC45A2 corresponding to a region with amino acids IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC
Assay Information SLC45A2 Blocking Peptide, catalog no. 33R-3980, is also available for use as a blocking control in assays to test for specificity of this SLC45A2 antibody

Images

Western Blot analysis using SLC45A2 antibody (70R-6692)

SLC45A2 antibody (70R-6692) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC45A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC45A2 is a melanocyte differentiation antigen that is expressed in a high percentage of melanoma cell lines. A similar sequence gene in medaka, 'B,' encodes a transporter that mediates melanin synthesis. Mutations in this gene are a cause of oculocutaneous albinism type 4.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC45A2 antibody (70R-6692) | SLC45A2 antibody (70R-6692) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors