SLC46A1 antibody (70R-6536)

Rabbit polyclonal SLC46A1 antibody

Synonyms Polyclonal SLC46A1 antibody, Anti-SLC46A1 antibody, PCFT antibody, Folate Transporter 1 antibody, HCP1 antibody, SLCA1 46 antibody, SLCA1-46 antibody, SLC46A1, Solute Carrier Family 46 Member 1 antibody, MGC9564 antibody, SLCA1-46, SLCA1 46
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLC46A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHR
Assay Information SLC46A1 Blocking Peptide, catalog no. 33R-5921, is also available for use as a blocking control in assays to test for specificity of this SLC46A1 antibody

Images

Western Blot analysis using SLC46A1 antibody (70R-6536)

SLC46A1 antibody (70R-6536) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC46A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a transmembrane proton-coupled folate transporter protein that facilitates the movement of folate and antifolate substrates across cell membranes optimally in acidic pH environments.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC46A1 antibody (70R-6536) | SLC46A1 antibody (70R-6536) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors