SLC5A5 antibody (70R-6763)

Rabbit polyclonal SLC5A5 antibody

Synonyms Polyclonal SLC5A5 antibody, Anti-SLC5A5 antibody, SLCA 5, SLCA 5 antibody, SLCA-5, SLCA-5 antibody, Sodium Iodide Symporter 5 antibody, NIS antibody, SLC5A5, Solute Carrier Family 5 Member 5 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC5A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSR
Assay Information SLC5A5 Blocking Peptide, catalog no. 33R-8989, is also available for use as a blocking control in assays to test for specificity of this SLC5A5 antibody


Western Blot analysis using SLC5A5 antibody (70R-6763)

SLC5A5 antibody (70R-6763) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC5A5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The sodium-iodide symporter (NIS, or SLC5A5) is a key plasma membrane protein that mediates active I- uptake in thyroid, lactating breast, and other tissues with an electrogenic stoichiometry of 2 Na+ per I-. In thyroid, NIS-mediated I- uptake is the first step in the biosynthesis of iodine-containing thyroid hormones.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC5A5 antibody (70R-6763) | SLC5A5 antibody (70R-6763) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors