SLC5A7 antibody (70R-7211)

Rabbit polyclonal SLC5A7 antibody

Synonyms Polyclonal SLC5A7 antibody, Anti-SLC5A7 antibody, hCHT antibody, SLCA7 5 antibody, Choline Tansporter 7 antibody, Solute Carrier Family 5 Member 7 antibody, CHT antibody, CHT1 antibody, SLCA7-5, SLC5A7, MGC126299 antibody, SLCA7-5 antibody, SLCA7 5, MGC126300 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLC5A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAV
Assay Information SLC5A7 Blocking Peptide, catalog no. 33R-1884, is also available for use as a blocking control in assays to test for specificity of this SLC5A7 antibody

Images

Western Blot analysis using SLC5A7 antibody (70R-7211)

SLC5A7 antibody (70R-7211) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC5A7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Choline is a direct precursor of acetylcholine (ACh), a neurotransmitter of the central and peripheral nervous system that regulates a variety of autonomic, cognitive, and motor functions. SLC5A7 is a Na(+)- and Cl(-)- dependent high-affinity transporter that mediates the uptake of choline for acetylcholine synthesis in cholinergic neurons.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC5A7 antibody (70R-7211) | SLC5A7 antibody (70R-7211) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors