SLC5A9 antibody (70R-6790)

Rabbit polyclonal SLC5A9 antibody

Synonyms Polyclonal SLC5A9 antibody, Anti-SLC5A9 antibody, SLC5A9, Sodium/Glucose Cotransporter 9 antibody, SLCA9-5, SLCA9 5 antibody, SGLT4 antibody, MGC132517 antibody, MGC132523 antibody, SLCA9 5, SLCA9-5 antibody, Solute Carrier Family 5 Member 9 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC5A9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFVIA
Assay Information SLC5A9 Blocking Peptide, catalog no. 33R-6447, is also available for use as a blocking control in assays to test for specificity of this SLC5A9 antibody

Images

Western Blot analysis using SLC5A9 antibody (70R-6790)

SLC5A9 antibody (70R-6790) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC5A9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC5A9 is involved in sodium-dependent transport of D-mannose, D-glucose and D-fructose.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC5A9 antibody (70R-6790) | SLC5A9 antibody (70R-6790) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors