SLC6A1 antibody (70R-6761)

Rabbit polyclonal SLC6A1 antibody

Synonyms Polyclonal SLC6A1 antibody, Anti-SLC6A1 antibody, SLCA1 6, SLCA1-6, SLCA1-6 antibody, SLCA1 6 antibody, GABATHG antibody, Neurotransmitter Transporter Gaba 1 antibody, Solute Carrier Family 6 Member 1 antibody, SLC6A1, GABATR antibody, GAT1 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC6A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIILFFRGVTLPGAKEGILFYITPNFRKLSDSEVWLDAATQIFFSYGLGL
Assay Information SLC6A1 Blocking Peptide, catalog no. 33R-5046, is also available for use as a blocking control in assays to test for specificity of this SLC6A1 antibody

Images

Western Blot analysis using SLC6A1 antibody (70R-6761)

SLC6A1 antibody (70R-6761) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC6A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC6A1 terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals. This protein is the target of psychomotor stimulants such as amphetamines or cocaine.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC6A1 antibody (70R-6761) | SLC6A1 antibody (70R-6761) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors