SLC6A15 antibody (70R-6563)

Rabbit polyclonal SLC6A15 antibody

Synonyms Polyclonal SLC6A15 antibody, Anti-SLC6A15 antibody, DKFZp761I0921 antibody, Solute Carrier Family 6 Member 15 antibody, MGC87066 antibody, NTT73 antibody, SLC6A15, Neutral Amino Acid Transporter 15 antibody, hv7-3 antibody, SLCA15-6, V7-3 antibody, SLCA15 6 antibody, FLJ10316 antibody, SLCA15-6 antibody, SLCA15 6
Cross Reactivity Human
Applications WB
Immunogen SLC6A15 antibody was raised using a synthetic peptide corresponding to a region with amino acids YISPLMLLSLLIASVVNMGLSPPGYNAWIEDKASEEFLSYPTWGLVVCVS
Assay Information SLC6A15 Blocking Peptide, catalog no. 33R-10141, is also available for use as a blocking control in assays to test for specificity of this SLC6A15 antibody

Images

Western Blot analysis using SLC6A15 antibody (70R-6563)

SLC6A15 antibody (70R-6563) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 82 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC6A15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC6A15 shows structural characteristics of an Na(+) and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC6A15 antibody (70R-6563) | SLC6A15 antibody (70R-6563) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors