SLC6A5 antibody (70R-6566)

Rabbit polyclonal SLC6A5 antibody

Synonyms Polyclonal SLC6A5 antibody, Anti-SLC6A5 antibody, SLC6A5, Solute Carrier Family 6 Member 5 antibody, SLCA5-6 antibody, SLCA5 6, SLCA5 6 antibody, GLYT2 antibody, NET1 antibody, Neurotransmitter Transporter Glycine 5 antibody, SLCA5-6
Cross Reactivity Human
Applications WB
Immunogen SLC6A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPE
Assay Information SLC6A5 Blocking Peptide, catalog no. 33R-5068, is also available for use as a blocking control in assays to test for specificity of this SLC6A5 antibody

Images

Western Blot analysis using SLC6A5 antibody (70R-6566)

SLC6A5 antibody (70R-6566) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 87 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC6A5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a sodium- and chloride-dependent glycine neurotransmitter transporter. This integral membrane glycoprotein is responsible for the clearance of extracellular glycine during glycine-mediated neurotransmission.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC6A5 antibody (70R-6566) | SLC6A5 antibody (70R-6566) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors