SLC7A1 antibody (70R-6772)

Rabbit polyclonal SLC7A1 antibody

Synonyms Polyclonal SLC7A1 antibody, Anti-SLC7A1 antibody, SLCA1-7, SLCA1 7, SLCA1 7 antibody, Solute Carrier Family 7 Member 1 antibody, CAT-1 antibody, Cationic Amino Acid Transporter Y+ System 1 antibody, SLCA1-7 antibody, ATRC1 antibody, HCAT1 antibody, ERR antibody, SLC7A1, REC1L antibody
Cross Reactivity Human
Applications WB
Immunogen SLC7A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPF
Assay Information SLC7A1 Blocking Peptide, catalog no. 33R-4972, is also available for use as a blocking control in assays to test for specificity of this SLC7A1 antibody

Images

Western Blot analysis using SLC7A1 antibody (70R-6772)

SLC7A1 antibody (70R-6772) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC7A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC7A1 is a high-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. It may also function as an ecotropic retroviral leukemia receptor.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC7A1 antibody (70R-6772) | SLC7A1 antibody (70R-6772) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors