SLC7A11 antibody (70R-6800)

Rabbit polyclonal SLC7A11 antibody

Synonyms Polyclonal SLC7A11 antibody, Anti-SLC7A11 antibody, SLCA11-7, Solute Carrier Family 7 Member 11 antibody, SLCA11-7 antibody, SLC7A11, CCBR1 antibody, SLCA11 7 antibody, SLCA11 7, xCT antibody, Cationic Amino Acid Transporter Y+ System 11 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC7A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids KGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEK
Assay Information SLC7A11 Blocking Peptide, catalog no. 33R-4402, is also available for use as a blocking control in assays to test for specificity of this SLC7A11 antibody

Images

Western Blot analysis using SLC7A11 antibody (70R-6800)

SLC7A11 antibody (70R-6800) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC7A11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC7A11 is a member of a heteromeric Na(+)-independent anionic amino acid transport system highly specific for cystine and glutamate. In this system, designated system Xc(-), the anionic form of cystine is transported in exchange for glutamate.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC7A11 antibody (70R-6800) | SLC7A11 antibody (70R-6800) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors