SLC7A2 antibody (70R-6789)

Rabbit polyclonal SLC7A2 antibody

Synonyms Polyclonal SLC7A2 antibody, Anti-SLC7A2 antibody, Cationic Amino Acid Transporter Y+ System 2 antibody, SLCA2-7 antibody, HCAT2 antibody, SLCA2-7, SLCA2 7, Solute Carrier Family 7 Member 2 antibody, CAT-2 antibody, SLCA2 7 antibody, ATRC2 antibody, SLC7A2
Cross Reactivity Human
Applications WB
Immunogen SLC7A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATC
Assay Information SLC7A2 Blocking Peptide, catalog no. 33R-9430, is also available for use as a blocking control in assays to test for specificity of this SLC7A2 antibody

Images

Western Blot analysis using SLC7A2 antibody (70R-6789)

SLC7A2 antibody (70R-6789) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 72 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC7A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC7A2 is a low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). SLC7A2 plays a regulatory role in classical or alternative activation of macrophages.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC7A2 antibody (70R-6789) | SLC7A2 antibody (70R-6789) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors