SLC8A3 antibody (70R-7350)

Rabbit polyclonal SLC8A3 antibody

Synonyms Polyclonal SLC8A3 antibody, Anti-SLC8A3 antibody, Solute Carrier Family 8 Member 3 antibody, SLCA3-8 antibody, SLCA3 8, Sodium-Calcium Exchanger 3 antibody, SLCA3 8 antibody, NCX3 antibody, SLC8A3, SLCA3-8
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLC8A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGE
Assay Information SLC8A3 Blocking Peptide, catalog no. 33R-8309, is also available for use as a blocking control in assays to test for specificity of this SLC8A3 antibody

Images

Western blot analysis using SLC8A3 antibody (70R-7350)

Recommended SLC8A3 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 103 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC8A3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC8A3 is a member of the sodium/calcium exchanger integral membrane protein family. Three mammalian isoforms in family 8 have been identified. Na+/Ca2+ exchange proteins are involved in maintaining Ca2+ homeostasis in a wide variety of cell types. The protein is regulated by intracellular calcium ions and is found in both the plasma membrane and intracellular organellar membranes, where exchange of Na+ for Ca2+ occurs in an electrogenic manner.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using SLC8A3 antibody (70R-7350) | Recommended SLC8A3 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors