SLC9A7 antibody (70R-7309)

Rabbit polyclonal SLC9A7 antibody

Synonyms Polyclonal SLC9A7 antibody, Anti-SLC9A7 antibody, Solute Carrier Family 9 Member 7 antibody, SLCA7 9, SLC9A6 antibody, Sodium/Hydrogen Exchanger 7 antibody, SLCA7-9 antibody, SLCA7 9 antibody, NHE7 antibody, SLCA7-9, SLC9A7
Cross Reactivity Human,Mouse
Applications WB
Immunogen SLC9A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQDSVSLLTFI
Assay Information SLC9A7 Blocking Peptide, catalog no. 33R-5001, is also available for use as a blocking control in assays to test for specificity of this SLC9A7 antibody

Images

Western Blot analysis using SLC9A7 antibody (70R-7309)

SLC9A7 antibody (70R-7309) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC9A7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Organelles of the secretory and endocytic pathways are distinguished by their luminal acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of internalized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. It may play an important role in maintaining cation homeostasis and function of the trans-Golgi network.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC9A7 antibody (70R-7309) | SLC9A7 antibody (70R-7309) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors