SLC9A8 antibody (70R-6801)

Rabbit polyclonal SLC9A8 antibody

Synonyms Polyclonal SLC9A8 antibody, Anti-SLC9A8 antibody, SLCA8-9 antibody, FLJ42500 antibody, SLC9A8, SLCA8 9, NHE8 antibody, DKFZp686C03237 antibody, KIAA0939 antibody, MGC138418 antibody, Sodium/Hydrogen Exchanger 8 antibody, SLCA8 9 antibody, SLCA8-9, Solute Carrier Family 9 Member 8 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLC9A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQELL
Assay Information SLC9A8 Blocking Peptide, catalog no. 33R-1315, is also available for use as a blocking control in assays to test for specificity of this SLC9A8 antibody

Images

Western Blot analysis using SLC9A8 antibody (70R-6801)

SLC9A8 antibody (70R-6801) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC9A8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Sodium-hydrogen exchangers (NHEs), such as SLC9A8, are integral transmembrane proteins that exchange extracellular Na+ for intracellular H+. NHEs have multiple functions, including intracellular pH homeostasis, cell volume regulation, and electroneutral NaCl absorption in epithelia.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC9A8 antibody (70R-6801) | SLC9A8 antibody (70R-6801) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors