SLCO1A2 antibody (70R-6567)

Rabbit polyclonal SLCO1A2 antibody raised against the middle region of SLCO1A2

Synonyms Polyclonal SLCO1A2 antibody, Anti-SLCO1A2 antibody, SLC21A3 antibody, SLCOA2 1 antibody, OATP1A2 antibody, SLCOA2-1, SLCOA2 1, OATP antibody, Solute Carrier Organic Anion Transporter Family Member 1A2 antibody, SLCO1A2, OATP-A antibody, SLCOA2-1 antibody
Specificity SLCO1A2 antibody was raised against the middle region of SLCO1A2
Cross Reactivity Human
Applications WB
Immunogen SLCO1A2 antibody was raised using the middle region of SLCO1A2 corresponding to a region with amino acids AIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTRWVGAWWFGFLIC
Assay Information SLCO1A2 Blocking Peptide, catalog no. 33R-1268, is also available for use as a blocking control in assays to test for specificity of this SLCO1A2 antibody

Images

Western Blot analysis using SLCO1A2 antibody (70R-6567)

SLCO1A2 antibody (70R-6567) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLCO1A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLCO1A2 is a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLCO1A2 antibody (70R-6567) | SLCO1A2 antibody (70R-6567) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors