SLCO1C1 antibody (70R-6553)

Rabbit polyclonal SLCO1C1 antibody raised against the N terminal of SLCO1C1

Synonyms Polyclonal SLCO1C1 antibody, Anti-SLCO1C1 antibody, SLCOC-1, OATP-F antibody, SLCOC 1, SLCOC 1 antibody, SLCO1C1, SLC21A14 antibody, OATP1 antibody, SLCOC-1 antibody, Solute Carrier Organic Anion Transporter Family Member 1C1 antibody, OATP1C1 antibody
Specificity SLCO1C1 antibody was raised against the N terminal of SLCO1C1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLCO1C1 antibody was raised using the N terminal of SLCO1C1 corresponding to a region with amino acids VDTSSSMWIYVFLGNLLRGIGETPIQPLGIAYLDDFASEDNAAFYIGCVQ
Assay Information SLCO1C1 Blocking Peptide, catalog no. 33R-9482, is also available for use as a blocking control in assays to test for specificity of this SLCO1C1 antibody

Images

Western Blot analysis using SLCO1C1 antibody (70R-6553)

SLCO1C1 antibody (70R-6553) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 79 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLCO1C1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLCO1C1 is a member of the organic anion transporter family. SLCO1C1 is a transmembrane receptor that mediates the sodium-independent uptake of thyroid hormones in brain tissues. This protein has particularly high affinity for the thyroid hormones thyroxine, tri-iodothyronine and reverse tri-iodothyronine. Polymorphisms in the gene encoding this protein may be associated with fatigue and depression in patients suffering from hyperthyroidism.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLCO1C1 antibody (70R-6553) | SLCO1C1 antibody (70R-6553) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors