SLCO2B1 antibody (70R-6720)

Rabbit polyclonal SLCO2B1 antibody raised against the N terminal of SLCO2B1

Synonyms Polyclonal SLCO2B1 antibody, Anti-SLCO2B1 antibody, Solute Carrier Organic Anion Transporter Family Member 2B1 antibody, SLC21A9 antibody, SLCOB1 2, OATP-B antibody, SLCOB1 2 antibody, SLCO2B1, OATP2B1 antibody, DKFZp686E0517 antibody, SLCOB1-2 antibody, OATPB antibody, KIAA0880 antibody, SLCOB1-2
Specificity SLCO2B1 antibody was raised against the N terminal of SLCO2B1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLCO2B1 antibody was raised using the N terminal of SLCO2B1 corresponding to a region with amino acids DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ
Assay Information SLCO2B1 Blocking Peptide, catalog no. 33R-2111, is also available for use as a blocking control in assays to test for specificity of this SLCO2B1 antibody

Images

Western Blot analysis using SLCO2B1 antibody (70R-6720)

SLCO2B1 antibody (70R-6720) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLCO2B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLCO2B1 mediates the Na+-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLCO2B1 antibody (70R-6720) | SLCO2B1 antibody (70R-6720) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors