SLCO3A1 antibody (70R-6586)

Rabbit polyclonal SLCO3A1 antibody raised against the middle region of SLCO3A1

Synonyms Polyclonal SLCO3A1 antibody, Anti-SLCO3A1 antibody, OATP-D antibody, SLCOA1 3, FLJ40478 antibody, SLCOA1-3, SLC21A11 antibody, SLCOA1-3 antibody, SLCOA1 3 antibody, SLCO3A1, Solute Carrier Organic Anion Transporter Family Member 3A1 antibody, OATP3A1 antibody
Specificity SLCO3A1 antibody was raised against the middle region of SLCO3A1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLCO3A1 antibody was raised using the middle region of SLCO3A1 corresponding to a region with amino acids MEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLL
Assay Information SLCO3A1 Blocking Peptide, catalog no. 33R-5925, is also available for use as a blocking control in assays to test for specificity of this SLCO3A1 antibody

Images

Western Blot analysis using SLCO3A1 antibody (70R-6586)

SLCO3A1 antibody (70R-6586) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLCO3A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLCO3A1 mediates the Na+-independent transport of organic anions such as estrone-3-sulfate. It mediates transport of prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123 and vasopressin, but not DPDPE (a derivative of enkephalin lacking an N-terminal tyrosine residue), estrone-3-sulfate, taurocholate, digoxin nor DHEAS.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLCO3A1 antibody (70R-6586) | SLCO3A1 antibody (70R-6586) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors