SLCO6A1 antibody (70R-1800)

Rabbit polyclonal SLCO6A1 antibody raised against the C terminal of SLCO6A1

Synonyms Polyclonal SLCO6A1 antibody, Anti-SLCO6A1 antibody, GST antibody, SLCOA1 6, SLCO6A1, OATP6A1 antibody, SLCOA1-6, SLCOA1 6 antibody, MGC26949 antibody, Solute Carrier Organic Anion Transporter Family Member 6A1 antibody, SLCOA1-6 antibody, OATPY antibody
Specificity SLCO6A1 antibody was raised against the C terminal of SLCO6A1
Cross Reactivity Human
Applications WB
Immunogen SLCO6A1 antibody was raised using the C terminal of SLCO6A1 corresponding to a region with amino acids LAMTRVVPDKLRSLALGVSYVILRIFGTIPGPSIFKMSGETSCILRDVNK
Assay Information SLCO6A1 Blocking Peptide, catalog no. 33R-4785, is also available for use as a blocking control in assays to test for specificity of this SLCO6A1 antibody

Images

Western Blot analysis using SLCO6A1 antibody (70R-1800)

SLCO6A1 antibody (70R-1800) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 79 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLCO6A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLCO6A1 is involved in transporter activity (solute carrier).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLCO6A1 antibody (70R-1800) | SLCO6A1 antibody (70R-1800) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors