SLFNL1 antibody (70R-3484)

Rabbit polyclonal SLFNL1 antibody raised against the middle region of SLFNL1

Synonyms Polyclonal SLFNL1 antibody, Anti-SLFNL1 antibody, Schlafen-Like 1 antibody, SLFNL 1 antibody, SLFNL-1 antibody, SLFNL 1, SLFNL-1, SLFNL1, MGC43873 antibody, FLJ23878 antibody
Specificity SLFNL1 antibody was raised against the middle region of SLFNL1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLFNL1 antibody was raised using the middle region of SLFNL1 corresponding to a region with amino acids TVHTPKAQSQPQLYQTDQGEVFLRRDGSIQGPLSASAIQEWCRQRWLVEL
Assay Information SLFNL1 Blocking Peptide, catalog no. 33R-9355, is also available for use as a blocking control in assays to test for specificity of this SLFNL1 antibody

Images

Western Blot analysis using SLFNL1 antibody (70R-3484)

SLFNL1 antibody (70R-3484) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLFNL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLFNL1 belongs to the Schlafen family. The function of the SLFNL1 protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLFNL1 antibody (70R-3484) | SLFNL1 antibody (70R-3484) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors