SLIT3 antibody (70R-6057)

Rabbit polyclonal SLIT3 antibody

Synonyms Polyclonal SLIT3 antibody, Anti-SLIT3 antibody, Slit-3 antibody, slit2 antibody, SLIT1 antibody, SLIL2 antibody, FLJ10764 antibody, MEGF5 antibody, Slit Homolog 3 antibody
Cross Reactivity Human
Applications WB
Immunogen SLIT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV
Assay Information SLIT3 Blocking Peptide, catalog no. 33R-7343, is also available for use as a blocking control in assays to test for specificity of this SLIT3 antibody

Images

Western Blot analysis using SLIT3 antibody (70R-6057)

SLIT3 antibody (70R-6057) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 168 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLIT3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLIT3 may act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLIT3 antibody (70R-6057) | SLIT3 antibody (70R-6057) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors