SLITRK1 antibody (70R-7285)

Rabbit polyclonal SLITRK1 antibody raised against the N terminal of SLITRK1

Synonyms Polyclonal SLITRK1 antibody, Anti-SLITRK1 antibody, SLITRK-1, SLITRK 1 antibody, KIAA1910 antibody, RP11-395N17.1 antibody, SLITRK-1 antibody, LRRC12 antibody, SLITRK1, KIAA0918 antibody, SLITRK 1, Slit And Ntrk-Like Family Member 1 antibody
Specificity SLITRK1 antibody was raised against the N terminal of SLITRK1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLITRK1 antibody was raised using the N terminal of SLITRK1 corresponding to a region with amino acids CDLLSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRV
Assay Information SLITRK1 Blocking Peptide, catalog no. 33R-1668, is also available for use as a blocking control in assays to test for specificity of this SLITRK1 antibody

Images

Western Blot analysis using SLITRK1 antibody (70R-7285)

SLITRK1 antibody (70R-7285) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 78 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLITRK1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the SLITRK family, such as SLITRK1, are integral membrane proteins with 2 N-terminal leucine-rich repeat (LRR) domains similar to those of SLIT proteins. Most SLITRKs, but not SLITRK1, also have C-terminal regions that share homology with neurotrophin receptors. SLITRKs are expressed predominantly in neural tissues and have neurite-modulating activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLITRK1 antibody (70R-7285) | SLITRK1 antibody (70R-7285) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors