SLITRK6 antibody (70R-7284)

Rabbit polyclonal SLITRK6 antibody raised against the N terminal of SLITRK6

Synonyms Polyclonal SLITRK6 antibody, Anti-SLITRK6 antibody, MGC119595 antibody, SLITRK-6 antibody, MGC119596 antibody, SLITRK6, SLITRK 6, SLITRK 6 antibody, MGC119597 antibody, Slit And Ntrk-Like Family Member 6 antibody, SLITRK-6
Specificity SLITRK6 antibody was raised against the N terminal of SLITRK6
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLITRK6 antibody was raised using the N terminal of SLITRK6 corresponding to a region with amino acids NFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQL
Assay Information SLITRK6 Blocking Peptide, catalog no. 33R-6684, is also available for use as a blocking control in assays to test for specificity of this SLITRK6 antibody


Western Blot analysis using SLITRK6 antibody (70R-7284)

SLITRK6 antibody (70R-7284) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 95 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLITRK6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the SLITRK family, such as SLITRK6, are integral membrane proteins with 2 N-terminal leucine-rich repeat (LRR) domains similar to those of SLIT proteins. Most SLITRKs, including SLITRK6, also have C-terminal regions that share homology with neurotrophin receptors. SLITRKs are expressed predominantly in neural tissues and have neurite-modulating activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLITRK6 antibody (70R-7284) | SLITRK6 antibody (70R-7284) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors