SLMO2 antibody (70R-4343)

Rabbit polyclonal SLMO2 antibody

Synonyms Polyclonal SLMO2 antibody, Anti-SLMO2 antibody, SLMO 2 antibody, SLMO-2 antibody, dJ543J19.5 antibody, Slowmo Homolog 2 antibody, C20orf45 antibody, SLMO 2, PRELID3B antibody, SLMO-2, SLMO2
Cross Reactivity Human
Applications WB
Immunogen SLMO2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GVDVLDRHIDPSGKLHSHRLLSTEWGLPSIVKSLIGAARTKTYVQEHSVV
Assay Information SLMO2 Blocking Peptide, catalog no. 33R-3632, is also available for use as a blocking control in assays to test for specificity of this SLMO2 antibody

Images

Western Blot analysis using SLMO2 antibody (70R-4343)

SLMO2 antibody (70R-4343) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLMO2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of SLMO2 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLMO2 antibody (70R-4343) | SLMO2 antibody (70R-4343) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors