SMC4 antibody (70R-5518)

Rabbit polyclonal SMC4 antibody raised against the middle region of SMC4

Synonyms Polyclonal SMC4 antibody, Anti-SMC4 antibody, hCAP-C antibody, CAPC antibody, SMC4, SMC 4, SMC-4 antibody, SMC4L1 antibody, Structural Maintenance Of Chromosomes 4 antibody, SMC-4, SMC 4 antibody
Specificity SMC4 antibody was raised against the middle region of SMC4
Cross Reactivity Human,Rat
Applications WB
Immunogen SMC4 antibody was raised using the middle region of SMC4 corresponding to a region with amino acids EARCHEMKPNLGAIAEYKKKEELYLQRVAELDKITYERDSFRQAYEDLRK
Assay Information SMC4 Blocking Peptide, catalog no. 33R-2280, is also available for use as a blocking control in assays to test for specificity of this SMC4 antibody


Western Blot analysis using SMC4 antibody (70R-5518)

SMC4 antibody (70R-5518) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 147 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SMC4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SMC4 is the central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SMC4 antibody (70R-5518) | SMC4 antibody (70R-5518) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors