SMCR7L antibody (70R-6378)

Rabbit polyclonal SMCR7L antibody raised against the N terminal of SMCR7L

Synonyms Polyclonal SMCR7L antibody, Anti-SMCR7L antibody, SMCR7L, dJ1104E15.3 antibody, SMCRL 7 antibody, SMCRL-7, SMCRL 7, Smith-Magenis Syndrome Chromosome Region Candidate 7-Like antibody, HSU79252 antibody, FLJ20232 antibody, SMCRL-7 antibody
Specificity SMCR7L antibody was raised against the N terminal of SMCR7L
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SMCR7L antibody was raised using the N terminal of SMCR7L corresponding to a region with amino acids GAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRSWEEPNWMGSPRLLN
Assay Information SMCR7L Blocking Peptide, catalog no. 33R-3147, is also available for use as a blocking control in assays to test for specificity of this SMCR7L antibody

Images

Western Blot analysis using SMCR7L antibody (70R-6378)

SMCR7L antibody (70R-6378) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SMCR7L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of SMCR7L protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SMCR7L antibody (70R-6378) | SMCR7L antibody (70R-6378) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors