SMN1 antibody (70R-4672)

Rabbit polyclonal SMN1 antibody raised against the N terminal of SMN1

Synonyms Polyclonal SMN1 antibody, Anti-SMN1 antibody, SMNT antibody, [email protected] antibody, SMN antibody, SMN1, Survival Of Motor Neuron 1 Telomeric antibody, T-BCD541 antibody, SMN-1 antibody, SMN 1 antibody, SMA antibody, SMN 1, SMA2 antibody, SMA1 antibody, SMA3 antibody, SMN-1, SMA4 antibody, BCD541 antibody
Specificity SMN1 antibody was raised against the N terminal of SMN1
Cross Reactivity Human,Dog
Applications WB
Immunogen SMN1 antibody was raised using the N terminal of SMN1 corresponding to a region with amino acids KAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKV
Assay Information SMN1 Blocking Peptide, catalog no. 33R-4261, is also available for use as a blocking control in assays to test for specificity of this SMN1 antibody


Western blot analysis using SMN1 antibody (70R-4672)

Recommended SMN1 Antibody


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SMN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SMN1 localizes to both the cytoplasm and the nucleus. Within the nucleus, the protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs). This protein forms heteromeric complexes with proteins such as SIP1 and GEMIN4, and also interacts with several proteins known to be involved in the biogenesis of snRNPs, such as hnRNP U protein and the small nucleolar RNA binding protein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using SMN1 antibody (70R-4672) | Recommended SMN1 Antibody
  • Western blot analysis using SMN1 antibody (70R-4672) | Tissue analyzed: Human Fetal Muscle; Antibody Dilution: 1.0ug/ml
  • Western blot analysis using SMN1 antibody (70R-4672) | Tissue analyzed: MCF7; Antibody Dilution: 1.0ug/ml
  • Western blot analysis using SMN1 antibody (70R-4672) | Tissue analyzed: Human Fetal Brain; Antibody Dilution: 1.0ug/m

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors