SMNDC1 antibody (70R-5033)

Rabbit polyclonal SMNDC1 antibody raised against the middle region of SMNDC1

Synonyms Polyclonal SMNDC1 antibody, Anti-SMNDC1 antibody, Survival Motor Neuron Domain Containing 1 antibody, SMNDC1, SMNDC-1, SMNDC-1 antibody, SPF30 antibody, SMNR antibody, SMNDC 1 antibody, SMNDC 1
Specificity SMNDC1 antibody was raised against the middle region of SMNDC1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SMNDC1 antibody was raised using the middle region of SMNDC1 corresponding to a region with amino acids QFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSK
Assay Information SMNDC1 Blocking Peptide, catalog no. 33R-7549, is also available for use as a blocking control in assays to test for specificity of this SMNDC1 antibody


Western Blot analysis using SMNDC1 antibody (70R-5033)

SMNDC1 antibody (70R-5033) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SMNDC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. SMNDC1 is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene. This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SMNDC1 antibody (70R-5033) | SMNDC1 antibody (70R-5033) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors