SMNDC1 antibody (70R-5034)

Rabbit polyclonal SMNDC1 antibody raised against the C terminal of SMNDC1

Synonyms Polyclonal SMNDC1 antibody, Anti-SMNDC1 antibody, SMNDC 1 antibody, SMNDC-1 antibody, SPF30 antibody, SMNDC-1, SMNDC 1, Survival Motor Neuron Domain Containing 1 antibody, SMNR antibody, SMNDC1
Specificity SMNDC1 antibody was raised against the C terminal of SMNDC1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SMNDC1 antibody was raised using the C terminal of SMNDC1 corresponding to a region with amino acids KGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ
Assay Information SMNDC1 Blocking Peptide, catalog no. 33R-4403, is also available for use as a blocking control in assays to test for specificity of this SMNDC1 antibody

Images

Western Blot analysis using SMNDC1 antibody (70R-5034)

SMNDC1 antibody (70R-5034) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SMNDC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. SMNDC1 is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene. This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SMNDC1 antibody (70R-5034) | SMNDC1 antibody (70R-5034) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors