SMPD1 antibody (70R-7120)

Rabbit polyclonal SMPD1 antibody raised against the middle region of SMPD1

Synonyms Polyclonal SMPD1 antibody, Anti-SMPD1 antibody, SMPD-1, SMPD 1 antibody, Sphingomyelin Phosphodiesterase 1 Acid Lysosomal antibody, ASM antibody, SMPD-1 antibody, NPD antibody, SMPD 1, SMPD1
Specificity SMPD1 antibody was raised against the middle region of SMPD1
Cross Reactivity Human
Applications WB
Immunogen SMPD1 antibody was raised using the middle region of SMPD1 corresponding to a region with amino acids INSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV
Assay Information SMPD1 Blocking Peptide, catalog no. 33R-4082, is also available for use as a blocking control in assays to test for specificity of this SMPD1 antibody

Images

Western Blot analysis using SMPD1 antibody (70R-7120)

SMPD1 antibody (70R-7120) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SMPD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SMPD1 is a lysosomal acid sphingomyelinase that converts sphingomyelin to ceramide. The encoded protein also has phospholipase C activity. Defects in this gene are a cause of Niemann-Pick disease type A (NPA) and Niemann-Pick disease type B (NPB).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SMPD1 antibody (70R-7120) | SMPD1 antibody (70R-7120) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors